HPA024647

CFAP77 antibody from Sigma-Aldrich
C9orf171, FLJ46082
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024647
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024647, RRID:AB_10601126
Product name
Anti-C9orf171 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024647
Antibody type
Polyclonal
Antigen
Uncharacterized protein C9orf171 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSAVQKVIPSLAGHHIKGGPQAELGKPRERSYSLP
GINFNYGLYIRGLDGGVPEAIGRWNVFKQQPTCPH
ELTRNYIAMN
Storage
-20C
Provider Type Product Number
- No reagents -