Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009748-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009748-M01, RRID:AB_714857
- Product name
- SLK monoclonal antibody (M01), clone 3E9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SLK.
- Antigen sequence
KHENQMRDLQLQCEANVRELHQLQNEKCHLLVEHE
TQKLKELDEEHSQELKEWREKLRPRKKTLEEEFAR
KLQEQEVFFKMTGESECLNPSTQSRISKFYPIPSL
HSTGS- Isotype
- IgG
- Antibody clone number
- 3E9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SLK monoclonal antibody (M01), clone 3E9 Western Blot analysis of SLK expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to SLK on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol