HPA026512

EBNA1BP2 antibody from Atlas Antibodies
EBP2, NOBP, P40
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026512
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026512, RRID:AB_1847954
Product name
Anti-EBNA1BP2
Provider product page
Atlas Antibodies - HPA026512
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ESDESLVTDRELQDAFSRGLLKPGLNVVLEGPKKA
VNDVNGLKQCLAEFKRDLEWVERLDVTLGPVPEIG
GSEAPAPQNKDQKAVDPEDD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -