Antibody data

Product number
PAB21801
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21801, RRID:AB_10963874
Product name
EBNA1BP2 polyclonal antibody
Provider product page
Abnova Corporation - PAB21801
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant EBNA1BP2.
Antigen sequence
ESDESLVTDRELQDAFSRGLLKPGLNVVLEGPKKA
VNDVNGLKQCLAEFKRDLEWVERLDVTLGPVPEIG
GSEAPAPQNKDQKAVDPEDD
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -