PAB22127

EBNA1BP2 antibody from Abnova Corporation
EBP2, NOBP, P40

Antibody data

Product number
PAB22127
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22127, RRID:AB_10961919
Product name
EBNA1BP2 polyclonal antibody
Provider product page
Abnova Corporation - PAB22127
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human EBNA1BP2.
Reactivity
Human
Host
Rabbit
Antigen sequence
SDKLDFLEGDQKPLAQRKKAGAKGQQMRKGPSAKR
RYKNQKFGFGGKKKGSKWNTRESYDDVSSFRAKTA
HGRGLKRPGKKGSNKRPGKRTREKMKNRTH
Isotype
IgG
Vial size
100 µl
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -