HPA028277

EBNA1BP2 antibody from Sigma-Aldrich
EBP2, NOBP, P40
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028277
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028277, RRID:AB_10603664
Product name
Anti-EBNA1BP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028277
Antibody type
Polyclonal
Antigen
EBNA1 binding protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SDKLDFLEGDQKPLAQRKKAGAKGQQMRKGPSAKR
RYKNQKFGFGGKKKGSKWNTRESYDDVSSFRAKTA
HGRGLKRPGKKGSNKRPGKRTREKMKNRTH
Storage
-20C
Provider Type Product Number
- No reagents -