HPA015284

HLTF antibody from Atlas Antibodies
HIP116A, HLTF1, RNF80, SMARCA3, SNF2L3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015284
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015284, RRID:AB_1234668
Product name
Anti-HLTF
Provider product page
Atlas Antibodies - HPA015284
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LKKHGFKLGPAPKTLGFNLESGWGSGRAGPSYSMP
VHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPA
EAIETPLLPHQKQALAWMVSRENSKELPPFWEQRN
DLYYNTITNFSEKDRPENVHGGILADDMGLGK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -