Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA015284 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA015284, RRID:AB_1857263
- Product name
- Anti-HLTF
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LKKHGFKLGPAPKTLGFNLESGWGSGRAGPSYSMP
VHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPA
EAIETPLLPHQKQALAWMVSRENSKELPPFWEQRN
DLYYNTITNFSEKDRPENVHGGILADDMGLGK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Helicase-like transcription factor: a new marker of well-differentiated thyroid cancers.
Role of helicase-like transcription factor (hltf) in the G2/m transition and apoptosis in brain.
Arcolia V, Paci P, Dhont L, Chantrain G, Sirtaine N, Decaestecker C, Remmelink M, Belayew A, Saussez S
BMC cancer 2014 Jul 8;14:492
BMC cancer 2014 Jul 8;14:492
Role of helicase-like transcription factor (hltf) in the G2/m transition and apoptosis in brain.
Helmer RA, Foreman O, Dertien JS, Panchoo M, Bhakta SM, Chilton BS
PloS one 2013;8(6):e66799
PloS one 2013;8(6):e66799
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows nuclear positivity of cells in seminiferus ducts.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cervix, uterine shows moderate to strong nuclear positivity in squamous epithelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
- Sample type
- HUMAN