HPA003127

COX8C antibody from Atlas Antibodies
COX8-3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003127
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003127, RRID:AB_611404
Product name
Anti-COX8C
Provider product page
Atlas Antibodies - HPA003127
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPR
QRPLSAAE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -