HPA003127

COX8C antibody from Sigma-Aldrich
COX8-3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003127
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003127, RRID:AB_1078560
Product name
Anti-COX8C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003127
Antibody type
Polyclonal
Antigen
Cytochrome c oxidase polypeptide 8 isoform 3, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPR
QRPLSAAE
Storage
-20C
Provider Type Product Number
- No reagents -