HPA007128

NFRKB antibody from Atlas Antibodies
DKFZp547B2013, INO80G
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007128
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007128, RRID:AB_1079482
Product name
Anti-NFRKB
Provider product page
Atlas Antibodies - HPA007128
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KSSSGVLLVSSPTMPHLGTMLSPASSQTAPSSQAA
ARVVSHSGSAGLSQVRVVAQPSLPAVPQQSGGPAQ
TLPQMPAGPQIRVPATATQTKVVPQTVMATVPVKA
QTTAATV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -