HPA007128

NFRKB antibody from Sigma-Aldrich
DKFZp547B2013, INO80G
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007128
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007128, RRID:AB_1079482
Product name
Anti-NFRKB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007128
Antibody type
Polyclonal
Antigen
Nuclear factor related to kappa-B-binding protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KSSSGVLLVSSPTMPHLGTMLSPASSQTAPSSQAA
ARVVSHSGSAGLSQVRVVAQPSLPAVPQQSGGPAQ
TLPQMPAGPQIRVPATATQTKVVPQTVMATVPVKA
QTTAATV
Storage
-20C
Provider Type Product Number
- No reagents -