HPA018035

SVOPL antibody from Sigma-Aldrich
MGC46715
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018035
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018035, RRID:AB_2197028
Product name
Anti-SVOPL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018035
Antibody type
Polyclonal
Antigen
Putative transporter SVOPL recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PESARFNVSTGNTRAALATLERVAKMNRSVMPEGK
LVEPVLEKRGRFADLLDAKYLRTTL
Storage
-20C
Provider Type Product Number
- No reagents -