HPA023139

SOX7 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023139
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023139, RRID:AB_1855384
Product name
Anti-AC105001.3-1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023139
Antibody type
Polyclonal
Antigen
Pin2-interacting protein X1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVH
YMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDA
SPSTP
Storage
-20C
Provider Type Product Number
- No reagents -