HPA021445

AK8 antibody from Atlas Antibodies
C9orf98, FLJ32704
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021445
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021445, RRID:AB_1845853
Product name
Anti-AK8
Provider product page
Atlas Antibodies - HPA021445
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KYRLVNVCCGQLLKEAVADRTTFGELIQPFFEKEM
AVPDSLLMKVLSQRLDQQDCIQKGWVLHGVPRDLD
QAHLLNRLGYNPNR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -