HPA021445

AK8 antibody from Sigma-Aldrich
C9orf98, FLJ32704
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021445
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021445, RRID:AB_1845853
Product name
Anti-C9orf98 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021445
Antibody type
Polyclonal
Antigen
Putative adenylate kinase-like protein C9orf98 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KYRLVNVCCGQLLKEAVADRTTFGELIQPFFEKEM
AVPDSLLMKVLSQRLDQQDCIQKGWVLHGVPRDLD
QAHLLNRLGYNPNR
Storage
-20C
Provider Type Product Number
- No reagents -