HPA023894

AK8 antibody from MilliporeSigma / Merck KGaA
C9orf98, FLJ32704
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023894
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA023894, RRID:AB_1845854
Product name
Anti-C9orf98 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA023894
Antibody type
Polyclonal
Antigen
Putative adenylate kinase-like protein C9orf98 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IPETREQALRIQTLGITPRHVIVLSAPDTVLIERN
LGKRIDPQTGEIYHTTFDWPPESEIQNRLMVPEDI
SELETAQKLLEYHRNIVRVIPSYPKILKVISADQP
CVD
Storage
-20C
Provider Type Product Number
- No reagents -