HPA021876

MBTD1 antibody from MilliporeSigma / Merck KGaA
FLJ20055, SA49P01
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021876
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA021876, RRID:AB_2140367
Product name
Anti-MBTD1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA021876
Antibody type
Polyclonal
Antigen
MBT domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TCWGDISENVRVEVPNTDCSLPTKVFWIAGIVKLA
GYNALLRYEGFENDSGLDFWCNICGSDIHPVGWCA
ASGKPL
Storage
-20C
Provider Type Product Number
- No reagents -