HPA016953

KAT5 antibody from Sigma-Aldrich
cPLA2, ESA1, HTATIP, HTATIP1, PLIP, TIP60, ZC2HC5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016953
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016953, RRID:AB_1851277
Product name
Anti-KAT5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016953
Antibody type
Polyclonal
Antigen
Histone acetyltransferase HTATIP recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVEVVSPATPVPSETAPASVFPQNGAARRAVAAQP
GRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSD
RSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQEL
TTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLR
Storage
-20C
Provider Type Product Number
- No reagents -