Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183736 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-General Transcription Factor IIIC, Polypeptide 5, 63kDa (GTF3C5) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GTF3C5 antibody: synthetic peptide directed towards the C terminal of human GTF3C5
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Xenopus
- Host
- Rabbit
- Antigen sequence
SKRPALFSSSAKADGGKEQLTYESGEDEEDEEEEE
EEEED FKPSDGSENE- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Cloning and characterization of two evolutionarily conserved subunits (TFIIIC102 and TFIIIC63) of human TFIIIC and their involvement in functional interactions with TFIIIB and RNA polymerase III.
In vivo activity of murine de novo methyltransferases, Dnmt3a and Dnmt3b.
Hsieh YJ, Wang Z, Kovelman R, Roeder RG
Molecular and cellular biology 1999 Jul;19(7):4944-52
Molecular and cellular biology 1999 Jul;19(7):4944-52
In vivo activity of murine de novo methyltransferases, Dnmt3a and Dnmt3b.
Hsieh CL
Molecular and cellular biology 1999 Dec;19(12):8211-8
Molecular and cellular biology 1999 Dec;19(12):8211-8
No comments: Submit comment
No validations: Submit validation data