Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA031257 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA031257, RRID:AB_2673812
- Product name
- Anti-TBXAS1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RGALMSAFSPEKLNEMVPLISQACDLLLAHLKRYA
ESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAP
EDPFVKHCKRFFEFCIP- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Downregulation of TBXAS1 in an iron-induced malignant mesothelioma model.
Minami D, Takigawa N, Kato Y, Kudo K, Isozaki H, Hashida S, Harada D, Ochi N, Fujii M, Kubo T, Ohashi K, Sato A, Tanaka T, Hotta K, Tabata M, Toyooka S, Tanimoto M, Kiura K
Cancer science 2015 Oct;106(10):1296-302
Cancer science 2015 Oct;106(10):1296-302
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human spleen and skin tissues using Anti-TBXAS1 antibody. Corresponding TBXAS1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in a subset of cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human spleen shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows low expression as expected.
- Sample type
- HUMAN