H00023235-B01

SIK2 antibody from Abnova Corporation
DKFZp434K1115, KIAA0781, LOH11CR1I, QIK, SNF1LK2

Antibody data

Product number
H00023235-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023235-B01, RRID:AB_1204993
Product name
SIK2 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00023235-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SIK2 protein.
Antigen sequence
MVMADGPRHLQRGPVRVGFYDIEGTLGKGNFAVVK
LGRHRITKTEVAIKIIDKSQLDAVNLEKIYREVQI
MKMLDHPHIIKLYQVMETKSMLYLVTEYAKNGEIF
DYLANHGRLNESEARRKFWQILSAVDYCHGRKIVH
RDLKAENLLLDNNMNIKIADFGFGNFFKSGELLAT
WCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVL
VCGALPFDGPTLPILRQRVLEGRFRIPYFMSEDCE
HLIRRMLVLDPSKRLTIAQIKEHKWMLIEVPVQRP
VLYPQEQENEPSIGEFNEQVLRLMHSLGIDQQKTI
ESLQNKSYNHFAAIYFLLVERLKSHRSSFPVEQRL
DGRQRRPSTIAEQTVAKAQTVGLPVTMHSPNMRLL
RSALLPQASNVEAFSFPASGCQAEAAFMEEECVDT
PKVNGCLLDPVPPVLVRKGCQSLPSNMMETSIDEG
LETEGEAEEDPAHAFEAFQSTRSGQRRHTLSEVTN
QLVVMPGAGKIFSMNDSPSLDSVDSEYDMGSVQRD
LNFLEDNPSLKDIMLANQPSPRMTSPFISLRPTNP
AMQALSSQKREVHNRSPVSFREGRRASDTSLTQGI
VAFRQHLQNLARTKGILELNKVQLLYEQIGPEADP
NLAPAAPQLQDLASSCPQEEVSQQQESVSTLPASV
HPQLSPRQSLETQYLQHRLQKPSLLSKAQNTCQLY
CKEPPRSLEQQLQEHRLQQKRLFLQKQSQLQAYFN
QMQIAESSYPQPSQQLPLPRQETPPPSQQAPPFSL
TQPLSPVLEPSSEQMQYSPFLSQYQEMQLQPLPST
SGPRAAPPLPTQLQQQQPPPPPPPPPPRQPGAAPA
PLQFSYQTCELPSAASPAPDYPTPCQYPVDGAQQS
DLTGPDCPRSPGLQEAPSSYDPLALSELPGLFDCE
MLDAVDPQHNGYVLVN
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -