HPA016026

SIK2 antibody from Sigma-Aldrich
DKFZp434K1115, KIAA0781, LOH11CR1I, QIK, SNF1LK2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016026
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016026, RRID:AB_1857321
Product name
Anti-SIK2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016026
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase SNF1-like kinase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HFAAIYFLLVERLKSHRSSFPVEQRLDGRQRRPST
IAEQTVAKAQTVGLPVTMHSPNMRLLRSALLPQAS
NVEAFSFPASGCQAEAAFMEEECVDTPKVNGCLLD
PVPPVLVRKGCQSLPSNMMETSIDEGLE
Storage
-20C
Provider Type Product Number
- No reagents -