Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006879-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006879-M01, RRID:AB_464020
- Product name
- TAF7 monoclonal antibody (M01), clone 2C5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TAF7.
- Antigen sequence
FIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEK
EVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDI
SSPGMSGHRQGHDSLEHDELREIFN- Isotype
- IgG
- Antibody clone number
- 2C5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Core promoter factor TAF9B regulates neuronal gene expression.
Taf7l cooperates with Trf2 to regulate spermiogenesis.
Dual functions of TAF7L in adipocyte differentiation.
Core promoter recognition complex changes accompany liver development.
Herrera FJ, Yamaguchi T, Roelink H, Tjian R
eLife 2014 Jul 8;3:e02559
eLife 2014 Jul 8;3:e02559
Taf7l cooperates with Trf2 to regulate spermiogenesis.
Zhou H, Grubisic I, Zheng K, He Y, Wang PJ, Kaplan T, Tjian R
Proceedings of the National Academy of Sciences of the United States of America 2013 Oct 15;110(42):16886-91
Proceedings of the National Academy of Sciences of the United States of America 2013 Oct 15;110(42):16886-91
Dual functions of TAF7L in adipocyte differentiation.
Zhou H, Kaplan T, Li Y, Grubisic I, Zhang Z, Wang PJ, Eisen MB, Tjian R
eLife 2013 Jan 8;2:e00170
eLife 2013 Jan 8;2:e00170
Core promoter recognition complex changes accompany liver development.
D'Alessio JA, Ng R, Willenbring H, Tjian R
Proceedings of the National Academy of Sciences of the United States of America 2011 Mar 8;108(10):3906-11
Proceedings of the National Academy of Sciences of the United States of America 2011 Mar 8;108(10):3906-11
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TAF7 monoclonal antibody (M01), clone 2C5 Western Blot analysis of TAF7 expression in MCF-7 ( Cat # L046V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of TAF7 expression in transfected 293T cell line by TAF7 monoclonal antibody (M01), clone 2C5.Lane 1: TAF7 transfected lysate(40.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TAF7 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to TAF7 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to TAF7 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to TAF7 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol