HPA014713

SLC37A3 antibody from Sigma-Aldrich
DKFZp761N0624
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014713
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014713, RRID:AB_1857131
Product name
Anti-SLC37A3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014713
Antibody type
Polyclonal
Antigen
Sugar phosphate exchanger 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TFSNVKVSISEQWTPSAFNTSVELPVEIWSSNHLF
PSAEKATL
Storage
-20C
Provider Type Product Number
- No reagents -