HPA024322

PRDM4 antibody from Atlas Antibodies
PFM1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024322
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024322, RRID:AB_1855691
Product name
Anti-PRDM4
Provider product page
Atlas Antibodies - HPA024322
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LSTSHNLASLESVSLHEVGLSLEPVAVSSITQEVA
MGTGHVDVSSDSLSFVSPSLQMEDSNSNKENMATL
FTIWCTLCDRAYPSDCPEHGPVTFVPDTPIESRAR
LSLPKQLVLRQSIVGAEVGVWTGETIPVRTCFGPL
IG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -