HPA024322

PRDM4 antibody from MilliporeSigma / Merck KGaA
PFM1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024322
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA024322, RRID:AB_1855691
Product name
Anti-PRDM4 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA024322
Antibody type
Polyclonal
Antigen
PR domain zinc finger protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSTSHNLASLESVSLHEVGLSLEPVAVSSITQEVA
MGTGHVDVSSDSLSFVSPSLQMEDSNSNKENMATL
FTIWCTLCDRAYPSDCPEHGPVTFVPDTPIESRAR
LSLPKQLVLRQSIVGAEVGVWTGETIPVRTCFGPL
IG
Storage
-20C
Provider Type Product Number
- No reagents -