HPA006982

TSHZ1 antibody from Atlas Antibodies
NY-CO-33, SDCCAG33, TSH1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006982
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006982, RRID:AB_1079886
Product name
Anti-TSHZ1
Provider product page
Atlas Antibodies - HPA006982
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YGSPFSESSDQLAHFKGSSSREEKEDPQCPDSVSY
PQDSLAQIKAVYANLFSESCWSSLALDLKKSGSTT
STNDASQKESSAPTPTPPTCPVSTTGPTTSTPSTS
CSSSTSHSSTTSTSSSSGYDWHQAALAKTLQQTSS
YGLLPEPS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -