HPA021390

FICD antibody from Sigma-Aldrich
HIP13, HYPE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021390
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021390, RRID:AB_1851340
Product name
Anti-FICD antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021390
Antibody type
Polyclonal
Antigen
FIC domain-containing protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CLAVLKGLYLLRSKPDRAQHAATKCTSPSTELSIT
SRGATLLVAKTKASPAGKLEARAALNQALEMKRQG
KREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKD
IIQADYLYTRALTISPYHEKALVNRDRTLPLVEEI
DQRYFSIID
Storage
-20C
Provider Type Product Number
- No reagents -