Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182926 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nucleophosmin (Nucleolar phosphoprotein B23, Numatrin) (NPM1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NPM1 antibody: synthetic peptide directed towards the middle region of human NPM1
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Rabbit
- Host
- Rabbit
- Antigen sequence
VSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEE
DAESE DEEEEDVKLL- Vial size
- 0.1 mg
Submitted references Cytoplasmic nucleophosmin in acute myelogenous leukemia with a normal karyotype.
Falini B, Mecucci C, Tiacci E, Alcalay M, Rosati R, Pasqualucci L, La Starza R, Diverio D, Colombo E, Santucci A, Bigerna B, Pacini R, Pucciarini A, Liso A, Vignetti M, Fazi P, Meani N, Pettirossi V, Saglio G, Mandelli F, Lo-Coco F, Pelicci PG, Martelli MF, GIMEMA Acute Leukemia Working Party
The New England journal of medicine 2005 Jan 20;352(3):254-66
The New England journal of medicine 2005 Jan 20;352(3):254-66
No comments: Submit comment
No validations: Submit validation data