Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182925 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Nucleophosmin (Nucleolar phosphoprotein B23, Numatrin) (NPM1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NPM1 antibody: synthetic peptide directed towards the N terminal of human NPM1
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Rabbit
- Host
- Rabbit
- Antigen sequence
DMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEH
QLSLR TVSLGAGAKD- Vial size
- 0.1 mg
Submitted references Adenovirus type 5 E1A and E6 proteins of low-risk cutaneous beta-human papillomaviruses suppress cell transformation through interaction with FOXK1/K2 transcription factors.
The splicing factor SC35 has an active role in transcriptional elongation.
Cytoplasmic nucleophosmin in acute myelogenous leukemia with a normal karyotype.
Komorek J, Kuppuswamy M, Subramanian T, Vijayalingam S, Lomonosova E, Zhao LJ, Mymryk JS, Schmitt K, Chinnadurai G
Journal of virology 2010 Mar;84(6):2719-31
Journal of virology 2010 Mar;84(6):2719-31
The splicing factor SC35 has an active role in transcriptional elongation.
Lin S, Coutinho-Mansfield G, Wang D, Pandit S, Fu XD
Nature structural & molecular biology 2008 Aug;15(8):819-26
Nature structural & molecular biology 2008 Aug;15(8):819-26
Cytoplasmic nucleophosmin in acute myelogenous leukemia with a normal karyotype.
Falini B, Mecucci C, Tiacci E, Alcalay M, Rosati R, Pasqualucci L, La Starza R, Diverio D, Colombo E, Santucci A, Bigerna B, Pacini R, Pucciarini A, Liso A, Vignetti M, Fazi P, Meani N, Pettirossi V, Saglio G, Mandelli F, Lo-Coco F, Pelicci PG, Martelli MF, GIMEMA Acute Leukemia Working Party
The New England journal of medicine 2005 Jan 20;352(3):254-66
The New England journal of medicine 2005 Jan 20;352(3):254-66
No comments: Submit comment
No validations: Submit validation data