HPA011384

NPM1 antibody from Sigma-Aldrich
B23, NPM
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011384
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011384, RRID:AB_1854692
Product name
Anti-NPM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011384
Antibody type
Polyclonal
Antigen
Nucleophosmin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKV
PQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEA
EEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPR
S
Storage
-20C
Provider Type Product Number
- No reagents -