HPA006471

ZSCAN22 antibody from Sigma-Aldrich
HKR2, ZNF50
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006471
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006471, RRID:AB_2221026
Product name
Anti-ZSCAN22 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006471
Antibody type
Polyclonal
Antigen
Zinc finger and SCAN domain-containing protein 22 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TQVLDKRGWDPGAEPTEASCKQSDLGESEPSNVTE
TLMGGVSLGPAFVKACEPEGSSERSGLSGEIWTKS
VTQQIHFKKTSGPYKDVPTDQRGRESGASRNSSSA
WPNLTSQ
Storage
-20C
Provider Type Product Number
- No reagents -