Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310471 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-STEAP Family Member 3, Metalloreductase (STEAP3) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-STEAP3 antibody: synthetic peptide directed towards the C terminal of human STEAP3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLT
LLVPC VVILAKALFL- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Structure of the membrane proximal oxidoreductase domain of human Steap3, the dominant ferrireductase of the erythroid transferrin cycle.
Sendamarai AK, Ohgami RS, Fleming MD, Lawrence CM
Proceedings of the National Academy of Sciences of the United States of America 2008 May 27;105(21):7410-5
Proceedings of the National Academy of Sciences of the United States of America 2008 May 27;105(21):7410-5
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting