HPA029553

ZNF114 antibody from Atlas Antibodies
MGC17986
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA029553
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA029553, RRID:AB_10603005
Product name
Anti-ZNF114
Provider product page
Atlas Antibodies - HPA029553
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DSIRQCILTRDSSIFKYNPVLNDSQKTHENNEDDG
VLGWNIQWVPCGRKTELKSSTWTGSQNTVHHIRDE
IDTG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -