Antibody data

Product number
PAB22302
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22302, RRID:AB_10962659
Product name
ZNF114 polyclonal antibody
Provider product page
Abnova Corporation - PAB22302
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ZNF114.
Antigen sequence
DSIRQCILTRDSSIFKYNPVLNDSQKTHENNEDDG
VLGWNIQWVPCGRKTELKSSTWTGSQNTVHHIRDE
IDTG
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -