HPA025019

ZNF114 antibody from Sigma-Aldrich
MGC17986
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025019
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025019, RRID:AB_1859080
Product name
Anti-ZNF114 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025019
Antibody type
Polyclonal
Antigen
Zinc finger protein 114 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPKRTFPEANRVCLTSISSQHSTLREDWRCPKTEE
PHRQGVNNVKPPAVAPEKDESPVSICEDHEMRNHS
KPTC
Storage
-20C
Provider Type Product Number
- No reagents -