HPA003394

SPTB antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003394
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003394, RRID:AB_1080076
Product name
Anti-SPTB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003394
Antibody type
Polyclonal
Antigen
Spectrin beta-chain, erythrocyte recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TSVLILQRKHKAFEDELRGLDAHLEQIFQEAHGMV
ARKQFGHPQIEARIKEVSAQWDQLKDLAAFCKKNL
QDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQD
EGATRALGKKHKDFLEELEESRGVMEHLEQQAQGF
PEEF
Storage
-20C
Provider Type Product Number
- No reagents -