Antibody data

Product number
H00054434-M12
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00054434-M12, RRID:AB_1714716
Product name
SSH1 monoclonal antibody (M12), clone 2F9
Provider product page
Abnova Corporation - H00054434-M12
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SSH1.
Antigen sequence
PKSLLLKNSHCDKNPPSTEVVIKEESSPKKDMKPA
KDLRLLFSNESEKPTTNSYLMQHQESIIQLQKAGL
VRKHTKELERLKSVPADPAPPSRDGPAS
Isotype
IgG
Antibody clone number
2F9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -