HPA019845

SSH1 antibody from Sigma-Aldrich
KIAA1298, SSH1L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019845
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019845, RRID:AB_1857497
Product name
Anti-SSH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019845
Antibody type
Polyclonal
Antigen
Protein phosphatase Slingshot homolog 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LCEKDVKKKLEFGSPKGRSGSLLQVEETEREEGLG
AGRWGQLPTQLDQNLLNSENLNNNSKRSCPNGMED
DAIFGILNKVKPSYKSCADCMYPTASGAPEASRER
CEDPNAPAICTQPAFLPHITSSPVAHLASRS
Storage
-20C
Provider Type Product Number
- No reagents -