Antibody data

Product number
H00006344-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006344-M01, RRID:AB_1137435
Product name
SCTR monoclonal antibody (M01), clone 3H1
Provider product page
Abnova Corporation - H00006344-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SCTR.
Antigen sequence
CDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGC
EGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNG
SLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRH
SYLLK
Isotype
IgG
Antibody clone number
3H1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -