HPA007269

SCTR antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007269
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007269, RRID:AB_1856640
Product name
Anti-SCTR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007269
Antibody type
Polyclonal
Antigen
Secretin receptor Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGC
EGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNG
SLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRH
SYLLKL
Storage
-20C
Provider Type Product Number
- No reagents -