Antibody data

Product number
PAB21312
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21312, RRID:AB_10986779
Product name
LOC136242 polyclonal antibody
Provider product page
Abnova Corporation - PAB21312
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant LOC136242.
Antigen sequence
PQDDLMLIKLAKPAMLNPKVQPLTLATTNVRPGTV
CLLSGLDWSQENSGRHPDLRQNLEAPVMSDREC
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -