HPA020541

PRSS37 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020541
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020541, RRID:AB_1853004
Product name
Anti-AC093638.4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020541
Antibody type
Polyclonal
Antigen
Peptidase S1 domain-containing protein LOC136242 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PQDDLMLIKLAKPAMLNPKVQPLTLATTNVRPGTV
CLLSGLDWSQENSGRHPDLRQNLEAPVMSDREC
Storage
-20C
Provider Type Product Number
- No reagents -