HPA006686

ZNF396 antibody from Sigma-Aldrich
FLJ31213, ZSCAN14
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006686
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006686, RRID:AB_1080710
Product name
Anti-ZNF396 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006686
Antibody type
Polyclonal
Antigen
Zinc finger protein 396 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FEKRQGNPSWKKQQKCDECGKIFSQSSALILHQRI
HSGKKPYACDECAKAFSRSAILIQHRRTHTDSKYE
HAIAEAQKNMYFKTRLKCPRSLSG
Storage
-20C
Provider Type Product Number
- No reagents -