H00006837-M01

MED22 antibody from Abnova Corporation
Med24, SRB6, SURF5
No application information provided.

Antibody data

Product number
H00006837-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006837-M01, RRID:AB_1137483
Product name
SURF5 monoclonal antibody (M01), clone 3A9
Provider product page
Abnova Corporation - H00006837-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SURF5.
Antigen sequence
MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTE
IIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVR
AGESLMKLVSDLKQFLILNDFPSVNEAIDQ
Isotype
IgG
Antibody clone number
3A9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -