HPA020391

MED22 antibody from Sigma-Aldrich
Med24, SRB6, SURF5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020391
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020391, RRID:AB_1857668
Product name
Anti-MED22 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020391
Antibody type
Polyclonal
Antigen
Mediator of RNA polymerase II transcription subunit 22 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTE
IIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVR
AGESLMKLVSDLKQFLILNDFPSVNEAIDQRN
Storage
-20C
Provider Type Product Number
- No reagents -