HPA019351

PTPN4 antibody from Sigma-Aldrich
PTPMEG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019351
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019351, RRID:AB_1855928
Product name
Anti-PTPN4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019351
Antibody type
Polyclonal
Antigen
Tyrosine-protein phosphatase non-receptor type 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYG
CYQVTCHSEEGNTAYIFRKMTLFNQEKNESRPLTQ
IQYIAWPDHGVPDDSSDFL
Storage
-20C
Provider Type Product Number
- No reagents -