HPA023453

MRPS23 antibody from Atlas Antibodies
CGI-138, HSPC329, MRP-S23
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023453
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023453, RRID:AB_1854125
Product name
Anti-MRPS23
Provider product page
Atlas Antibodies - HPA023453
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FNPNFKSTCQRFVEKYTELQKLGETDEEKLFVETG
KALLAEGVILRRVGEARTQHGGSHVSRKSEHLSVR
PQTALEENETQKEVPQD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -