HPA024836

CUEDC1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024836
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024836, RRID:AB_1847333
Product name
Anti-CUEDC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024836
Antibody type
Polyclonal
Antigen
CUE domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VPGTGDANPAVSEDALFRDKLKHMGKSTRRKLFEL
ARAFSEKTKMRKSKRKHLLKHQSLGAAASTANLLD
DVEGHACDEDFRGRRQEAPKVEEGLREGQ
Storage
-20C
Provider Type Product Number
- No reagents -