HPA006687

ZHX3 antibody from Sigma-Aldrich
KIAA0395, TIX1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006687
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006687, RRID:AB_1080655
Product name
Anti-ZHX3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006687
Antibody type
Polyclonal
Antigen
Zinc fingers and homeoboxes protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PEGLSLHNATCHSGEASFVWNVAKPDNHVVVEQSI
PESTSTPDLAGEPSAEGADGQAEIIITKTPIMKIM
KGKAEAKKIHTLKENVPSQPVGEALPKLSTGEM
Storage
-20C
Provider Type Product Number
- No reagents -